Complete the following class. You have a string which represents part of a protein sequence and a set of identifiers from a well known protein database. Use BioJava to work out which ID the sequence comes from.
package uk.ac.ncl.csc8311; public class ProteinSearch { static String sequence = "GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP"; static String[] uniprot = {"O60016", "Q10426", "O74910", "Q96AT9", "P16435", "Q9UBN7", "P30566", "P08100", "P20718", "Q99707" }; public static void main(String[] args) throws Exception { } }